DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and Rlbp1

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001166954.1 Gene:Rlbp1 / 19771 MGIID:97930 Length:317 Species:Mus musculus


Alignment Length:252 Identity:76/252 - (30%)
Similarity:128/252 - (50%) Gaps:13/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AKEELHEDENIRRQALAQFREWIEKHPHI----------RKCRTDTVFLLRFLRTKKFSVPSACE 93
            ||:||:|.|..|.:|:.:.:|.::.....          |....|:.|||||:|.:||.|..|.|
Mouse    48 AKDELNEKEETREEAVRELQELVQAQAASGEELALAVAERVQARDSAFLLRFIRARKFDVGRAYE 112

  Fly    94 MLERYLTIRQLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDPYKFTSVQ 158
            :|:.|:..|..:|:.|..|.:.  |:....|.||...|..||..||.|:......:...:.|..:
Mouse   113 LLKGYVNFRLQYPELFDSLSME--ALRCTIEAGYPGVLSSRDKYGRVVMLFNIENWHCEEVTFDE 175

  Fly   159 MARVHSLVCEALLDDEDSQVAGYVYINDESGMNMGFVSLWSLTDLRSIVKCIQNSTPMRHKETHF 223
            :.:.:..:.|.||::|::|:.|:..:.:..|..|...:....:||:.:|..:|:|.|.|.|..||
Mouse   176 ILQAYCFILEKLLENEETQINGFCIVENFKGFTMQQAAGLRPSDLKKMVDMLQDSFPARFKAIHF 240

  Fly   224 VNIPHYANRIIELGVSMLSDKLKKRIIVH-KNVDILKTKIDPAILPKEYGGTVPIAD 279
            ::.|.|......:....|.:||.:|:.|| .::|....:||..|||.::|||:|..|
Mouse   241 IHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENILPADFGGTLPKYD 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 16/55 (29%)
CRAL_TRIO 126..274 CDD:279044 42/148 (28%)
Rlbp1NP_001166954.1 CRAL_TRIO_N 60..117 CDD:215024 16/56 (29%)
CRAL_TRIO 143..292 CDD:395525 42/148 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8767
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.