DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and R03A10.5

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_510554.2 Gene:R03A10.5 / 181634 WormBaseID:WBGene00010985 Length:382 Species:Caenorhabditis elegans


Alignment Length:292 Identity:62/292 - (21%)
Similarity:109/292 - (37%) Gaps:82/292 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YDYPYVCGLSPAMKLVAKEELHEDENIRRQALAQFREWIEKHPHIRKCRTDTVFLLRFLRTKKFS 87
            ||...:..|...:|....|..:.|.||.|        |::.|        :|:.:....|..|| 
 Worm    11 YDLKKIQQLRELVKDDISEYYNTDFNILR--------WLQGH--------NTLPIEEIARKMKF- 58

  Fly    88 VPSACEMLERYLTIRQLFPQW----FKQLDINDPAINEIFENGYLVPLPQRDSTGRQVIFSV--- 145
                      :|.:|   ..|    ..:.:.|.| |::.::.|...|....|:    ||.::   
 Worm    59 ----------HLNLR---AAWNLDELHKKERNHP-IHKHWKYGITGPSGHMDN----VIVNIEQC 105

  Fly   146 -----AAKFDPYKFTSVQMARVHSL------VCEALLDDEDSQVAGYVYINDESGM-------NM 192
                 ....:.|....|..||:..|      |.|  |:.:..:.|..:|:.|.:|:       ::
 Worm   106 GKTDYTGMMETYSILEVMRARMVDLEQMLHHVME--LEAKTGKQAWILYVMDITGLQYNKKLYDL 168

  Fly   193 GFVSLWSLTDLRS--IVKCIQNSTPMRHKETHFVNIPHYANRIIELGVSMLSDKL--KKRIIVHK 253
            ...|:.||.|..:  .|:.|:...|        |.:|.:|..:..:...:|.:|.  |.|:|...
 Worm   169 VTGSMKSLADFMADHYVEMIKYFVP--------VCVPSFATALYVVVRPLLPEKTREKVRLIGET 225

  Fly   254 N--VDILKTKID---PAILPKE---YGGTVPI 277
            |  .|:|:..|.   |:|...|   :||.:.:
 Worm   226 NWRDDVLQYAIHSSLPSIWNNENHTFGGFIEL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 6/45 (13%)
CRAL_TRIO 126..274 CDD:279044 40/180 (22%)
R03A10.5NP_510554.2 SEC14 77..249 CDD:214706 42/186 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.