DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and F18A11.2

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_496771.1 Gene:F18A11.2 / 174945 WormBaseID:WBGene00008929 Length:388 Species:Caenorhabditis elegans


Alignment Length:237 Identity:48/237 - (20%)
Similarity:98/237 - (41%) Gaps:38/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ACEMLERYLTIRQLFPQWFKQLDINDPAINEIFENGYL---VPL----PQRDSTGRQVIFSVAAK 148
            |.:.|:|:|.||       |.:|:|..:.....|...|   ||:    .......:.::|....|
 Worm    46 AAKALKRHLNIR-------KTIDLNSYSSKTELEEDELNKYVPIDVIGQNHQDDNKVLMFERTGK 103

  Fly   149 FD---------PYKFTSVQ---MARVHSLVCEALLDDEDSQVAGYVYINDESGMNMGFVSLWSLT 201
            .|         .:||..::   |..||..|..|  :.:..:.:|.::|.|..|::.....:..||
 Worm   104 IDISGLVDNVLMHKFMQIKLKMMEGVHQKVVAA--ERKTGRQSGGLFIMDLDGISFSPKLISVLT 166

  Fly   202 -DLRSIVKCIQNSTPMRHKETHFVNIPHYANRIIELGVSMLSDKLKKRIIVHKN--VDILKTKID 263
             ..|.:...:.:..|...::...||.|.:.|.:.:.....|.:..|::|::...  :..::...|
 Worm   167 GPYRIMWGTLFDHYPQLLQKIIIVNAPSFVNVLHQACSPFLPEDYKEKIVITSEPAIGAIQKHAD 231

  Fly   264 PAILPKEYGG------TVPIADMIAQFKQ-KLQQRRAAILAL 298
            ...||.:.||      ::|:|......|: :.::.:.::||:
 Worm   232 KCFLPSDLGGDLEKTTSLPMAPFPKMNKKYEKEKEKVSLLAI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 2/6 (33%)
CRAL_TRIO 126..274 CDD:279044 33/175 (19%)
F18A11.2NP_496771.1 SEC14 72..244 CDD:214706 34/173 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.