DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and CLVS2

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens


Alignment Length:252 Identity:87/252 - (34%)
Similarity:131/252 - (51%) Gaps:1/252 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GLSPAMKLVAKEELHEDENIRRQALAQFREWIEKHPHIRKCRTDTVFLLRFLRTKKFSVPSACEM 94
            ||||.....|:.||:|:.:...|.:.:.|:.:...|.|...|||..|:|||||.:||....|..:
Human     7 GLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRL 71

  Fly    95 LERYLTIRQLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDPYKFTSVQM 159
            |.:|...||.....||.....||.|.:..::|:...|...|..||:::...||.:|..::|.|.:
Human    72 LAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDI 136

  Fly   160 ARVHSLVCEALLDDEDSQVAGYVYINDESGMNMGFVSLWSLTDLRSIVKCIQNSTPMRHKETHFV 224
            .|...|..||:::|.:.||.|:|.|.|.|.......|..:.:.||..::.:|:|.|.|....|||
Human   137 LRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFV 201

  Fly   225 NIPHYANRIIELGVSMLSDKLKKRIIVH-KNVDILKTKIDPAILPKEYGGTVPIADM 280
            |.|.|.:.:..:....|.:|.:|||.:| .|::.|...|.|.|||.|:||.:|..||
Human   202 NQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDM 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 17/45 (38%)
CRAL_TRIO 126..274 CDD:279044 50/148 (34%)
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 17/45 (38%)
SEC14 106..251 CDD:238099 48/144 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4448
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.