DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and C1R

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens


Alignment Length:406 Identity:116/406 - (28%)
Similarity:161/406 - (39%) Gaps:129/406 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 WTKCSPKCTTRRYKKCRIMDQCG--REVLR-EIAYCYTEG-----SFCQQWLQTQFQKTPAFETR 443
            |.:..|        :|:|.| ||  |.:.. :..|..|.|     :..|.:....:.|   .:||
Human   378 WHRAMP--------RCKIKD-CGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYK---MQTR 430

  Fly   444 PGSGSPANAMRRMQSEQPEVSMNDLNYIMTG--------KGYRGPEYTPLKLSCGIVRSGTGRRS 500
            .||         .:|||..       |..|.        ||.:.|...|:   ||...:...:|.
Human   431 AGS---------RESEQGV-------YTCTAQGIWKNEQKGEKIPRCLPV---CGKPVNPVEQRQ 476

  Fly   501 MSNMLKIIGGRAARKGEWPWQV--AILNRFKEAFCGGTLIAPRWVLTAAHCVRKVLFVRIGEHNL 563
                 :||||:.|:.|.:||||  .|..|     .||.|:..||:|||||    .|:.:  ||..
Human   477 -----RIIGGQKAKMGNFPWQVFTNIHGR-----GGGALLGDRWILTAAH----TLYPK--EHEA 525

  Fly   564 NYEDGTEIQL------RVMKSYTHP----------------NFDKRTVDSDVALLRLPKAVNATT 606
            ......::.|      .:||...||                ||     :.|:|||.|..:|.   
Human   526 QSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNF-----EGDIALLELENSVT--- 582

  Fly   607 WIGYSCLPQPFQALPKN---VDCTIIGWGKRRNRDATGTSVLHK--------ATVPIIPMQNCR- 659
             :|.:.||   ..||.|   .|..::|:       .:|..|:.:        ..:|:...|.|. 
Human   583 -LGPNLLP---ICLPDNDTFYDLGLMGY-------VSGFGVMEEKIAHDLRFVRLPVANPQACEN 636

  Fly   660 ----KVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPN-HPWTIFGITSFGDGCAQR 719
                |...| ..::|||||||.....|.|.|||||....||   || ..|...||.|:|.||:: 
Human   637 WLRGKNRMD-VFSQNMFCAGHPSLKQDACQGDSGGVFAVRD---PNTDRWVATGIVSWGIGCSR- 696

  Fly   720 NKFGIYAKVPNYVDWV 735
             .:|.|.||.|||||:
Human   697 -GYGFYTKVLNYVDWI 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 86/269 (32%)
Tryp_SPc 507..735 CDD:238113 86/268 (32%)
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569 2/14 (14%)
Sushi 390..461 CDD:306569 20/89 (22%)
Tryp_SPc 477..711 CDD:214473 86/269 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.