DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and Prss55

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:262 Identity:87/262 - (33%)
Similarity:128/262 - (48%) Gaps:19/262 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 CGIVRSGTGRRSMSNMLKIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRKV 553
            ||:......|...|   :||.|:.|..||:||||:| ......||||::::..|:||.|||....
Mouse    46 CGVRPLYDSRIQYS---RIIEGQEAELGEFPWQVSI-QESDHHFCGGSILSEWWILTVAHCFYAQ 106

  Fly   554 ------LFVRIGEHNLNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSC 612
                  |.||:|.::|.   .:.::|.|.....|..|.:..:|:|:|||.|.|.:.........|
Mouse   107 ELSPTDLRVRVGTNDLT---TSPVELEVTTIIRHKGFKRLNMDNDIALLLLAKPLTFNELTVPIC 168

  Fly   613 LPQPFQALPKNVDCTIIGWGKRRNRDATGTSV-LHKATVPIIPMQNCRKVYYDYTITKNMFCAGH 676
            ||. :.|.|...:|.:.|||...:.|....|. |.|..:.||..:.|.:::  .::|.||.||.:
Mouse   169 LPL-WPAPPSWHECWVAGWGVTNSTDKESMSTDLMKVPMRIIEWEECLQMF--PSLTTNMLCASY 230

  Fly   677 QKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVVNC 741
            .....|.|.|||||||:|  ||.|...|...||.|:|..|.::...|||..:..|..|:..:...
Mouse   231 GNESYDACQGDSGGPLVC--TTDPGSRWYQVGIISWGKSCGKKGFPGIYTVLAKYTLWIEKIAQT 293

  Fly   742 DG 743
            :|
Mouse   294 EG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 81/235 (34%)
Tryp_SPc 507..735 CDD:238113 81/234 (35%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 81/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.