DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG34458

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:260 Identity:67/260 - (25%)
Similarity:110/260 - (42%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 KIIGGRAARKGEWPWQVAI-LNRFKEAFCGGTLIAPRWVLTAAHCV-------RKVLFVRIGEHN 562
            :||||:.|..|::|.||:: ||  ....|||:||:...::|||||.       .|.:   :|.::
  Fly    31 RIIGGQFAAPGQFPHQVSLQLN--GRHHCGGSLISDTMIVTAAHCTMGQNPGQMKAI---VGTND 90

  Fly   563 LNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAV---NATTWI---------------- 608
            |:..:|.  ...:.:...||.::.::.|.|::|::|...|   .|...|                
  Fly    91 LSAGNGQ--TFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAADTMAM 153

  Fly   609 --GYSCLPQPFQALPKNVDCTIIG-WGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKN 670
              |:..:.|..| ||..:....:. |    :||     ..:...:|              .:|..
  Fly   154 ISGFGAINQNLQ-LPNRLKFAQVQLW----SRD-----YCNSQNIP--------------GLTDR 194

  Fly   671 MFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWV 735
            |.||||..|.:.:|.|||||||..        ...:||:.|:|.||..:.:..:|..|.....|:
  Fly   195 MVCAGHPSGQVSSCQGDSGGPLTV--------DGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWI 251

  Fly   736  735
              Fly   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 66/258 (26%)
Tryp_SPc 507..735 CDD:238113 66/257 (26%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 66/258 (26%)
Tryp_SPc 32..254 CDD:238113 67/259 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.