DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and KLK10

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:279 Identity:78/279 - (27%)
Similarity:126/279 - (45%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 SGTGRRSMSNMLKII------------------------GGRAARKGEWPWQVAILNRFKEAFCG 534
            :.:|.|:::.:|.::                        |...|| |..||||::.|.. ...|.
Human    10 AASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCAR-GSQPWQVSLFNGL-SFHCA 72

  Fly   535 GTLIAPRWVLTAAHCVRKVLFVRIGEHNLNYEDGTEIQLRVMKSYTHPNF--------DKRTVDS 591
            |.|:...||||||||..|.|:.|:|:.:|....|.::: |..:|..||.:        .:||.:.
Human    73 GVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLR-RTTRSVVHPKYHQGSGPILPRRTDEH 136

  Fly   592 DVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQ 656
            |:.||:|.:.|.....:  ..|..|::.......|.:.|||....|.......|..:::.|:..:
Human   137 DLMLLKLARPVVLGPRV--RALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPK 199

  Fly   657 NCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFG-DGCAQRN 720
            .| :|:|...:|.||.|||..:|. |.|..||||||:|.:|.:        ||.|:| ..|....
Human   200 EC-EVFYPGVVTNNMICAGLDRGQ-DPCQSDSGGPLVCDETLQ--------GILSWGVYPCGSAQ 254

  Fly   721 KFGIYAKVPNYVDWVWSVV 739
            ...:|.::..|:.|:..|:
Human   255 HPAVYTQICKYMSWINKVI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 73/261 (28%)
Tryp_SPc 507..735 CDD:238113 73/260 (28%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 74/237 (31%)
Tryp_SPc 49..269 CDD:214473 73/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.