DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and zgc:112038

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:242 Identity:84/242 - (34%)
Similarity:119/242 - (49%) Gaps:26/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   509 GGRAARKGEWPWQVAILNRF--KEAFCGGTLIAPRWVLTAAHCVRKVLFVRIGEHNL------NY 565
            ||..|..|.||||.:| :|.  ::..|||:||...|||:||||     |:.....|:      .:
Zfish    37 GGDDAVAGSWPWQASI-HRISPEDHICGGSLINKDWVLSAAHC-----FMITATANIKIFLGRQF 95

  Fly   566 EDGT---EIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDCT 627
            :.|:   ||...:.:...||::...|.::|:|||||..:|..|.:|...||..............
Zfish    96 QTGSNPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCLASADSVFAGGTKSW 160

  Fly   628 IIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDY--TITKNMFCAGHQKGHIDTCAGDSGG 690
            |.||.|.|:.|...|:||.:..:|::....|..   ||  .||.||.|||..:|..|.|.|||||
Zfish   161 ITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNA---DYKGIITDNMICAGINEGGKDACQGDSGG 222

  Fly   691 PLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWS 737
            |::.::.::    |...||.|||..|......|||.:|..|..|:.|
Zfish   223 PMVSQNGSR----WIQSGIVSFGRECGLPRYPGIYTRVSQYQSWITS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 82/238 (34%)
Tryp_SPc 507..735 CDD:238113 82/238 (34%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 82/238 (34%)
Tryp_SPc 37..263 CDD:238113 82/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.