DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and Try10

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001034085.1 Gene:Try10 / 436522 MGIID:3687012 Length:246 Species:Mus musculus


Alignment Length:234 Identity:86/234 - (36%)
Similarity:128/234 - (54%) Gaps:13/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRKVLFVRIGEHNLNYEDGTE 570
            ||:||...|:...|:||::.:.:.  ||||:||..:||::||||.:..:.||:||||:|..:|.|
Mouse    23 KIVGGYTCRENSVPYQVSLNSGYH--FCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNE 85

  Fly   571 IQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDCTIIGWGKRR 635
            ..:.......||.|.|:|:|:|:.|::|...|.....:....||....|  ....|.|.|||...
Mouse    86 QFIDAANIIKHPKFKKKTLDNDIMLIKLSSPVTLNARVATVALPSSCAA--AGTQCLISGWGNTL 148

  Fly   636 NRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKP 700
            :.......:|.....|::|..:| :..|...|||||.|.|..:|..|:|.||||||::|....: 
Mouse   149 SSGVNNPDLLQCLDAPLLPQADC-EASYPGKITKNMICVGFLEGGKDSCQGDSGGPVVCNGQLQ- 211

  Fly   701 NHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVV 739
                   ||.|:|.||||::..|:|.||.|||||:.:.:
Mouse   212 -------GIVSWGYGCAQKDNPGVYTKVCNYVDWIQNTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 85/228 (37%)
Tryp_SPc 507..735 CDD:238113 84/227 (37%)
Try10NP_001034085.1 Tryp_SPc 23..239 CDD:214473 85/228 (37%)
Tryp_SPc 24..242 CDD:238113 85/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134623
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.