DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG11313

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:275 Identity:90/275 - (32%)
Similarity:121/275 - (44%) Gaps:62/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 IIGGRAA----RKG------EWPWQVAILNRFKE-----AFCGGTLIAPRWVLTAAHCV------ 550
            |.||..|    .||      |:.|.|.:..|..:     .:|.|:||..|:|:||||||      
  Fly   106 ICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRA 170

  Fly   551 RK--VLF---VRIGEHN-------LNYEDGTE-IQLRVMKSYTHPNFDKRTVDSDVALLRLPKAV 602
            ||  |.|   ||:||||       ||.....| :|:.|.:...|.:|..|...:|:||:||.:.|
  Fly   171 RKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREV 235

  Fly   603 NATTWIGYSCLP--------QPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCR 659
            ..:..|...|||        |..||.      |:.|||  |...:..:.|..|..|..:....||
  Fly   236 AYSPSIRPVCLPSTVGLQNWQSGQAF------TVAGWG--RTLTSESSPVKMKLRVTYVEPGLCR 292

  Fly   660 KVYYDYTIT-KNMFCA-GHQKGHIDTCAGDSGGPLLCRDTTKPNHP--WTIFGITSFGDGCAQRN 720
            :.|....:. .:..|| |..:|  |:|.|||||||:.      .|.  |.:.||.|||..|..|.
  Fly   293 RKYASIVVLGDSHLCAEGRSRG--DSCDGDSGGPLMA------FHEGVWVLGGIVSFGLNCGSRF 349

  Fly   721 KFGIYAKVPNYVDWV 735
            ...:|..|.:|..|:
  Fly   350 WPAVYTNVLSYETWI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 89/273 (33%)
Tryp_SPc 507..735 CDD:238113 89/273 (33%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 86/265 (32%)
Tryp_SPc 116..364 CDD:214473 85/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.