DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and aqrs

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:231 Identity:46/231 - (19%)
Similarity:77/231 - (33%) Gaps:73/231 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 WQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRKVLFVRIGEH---NLNYEDGTEIQ--------- 572
            :.|.:||. ....|.|.||:.|.|:|:.||.:...|..|.|:   :|:...|.|:.         
  Fly    77 YYVNVLNE-GSVICAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELDDNPEPHQVI 140

  Fly   573 ---LRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDCTIIGWGKR 634
               :.|.|:....|:        ||||.|...::...   |..:|                  ..
  Fly   141 GFFMPVNKNERFTNY--------VALLALSNKLDRDK---YRYIP------------------LH 176

  Fly   635 RNRDATGTSV-----------LHKATVPIIPMQNC------RKVYYDYTITKNMFCAGHQKGHI- 681
            |.:...|..|           :......::.:..|      ::|::..|...:..|. ..|.|. 
  Fly   177 RKKPQAGDDVKMAYYGPPKFQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPDFICV-RNKRHSK 240

  Fly   682 -DTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGC 716
             .||:...|.|||..:        .:..|..:|:.|
  Fly   241 KTTCSTRPGDPLLIDN--------KLAAINIYGEHC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 46/231 (20%)
Tryp_SPc 507..735 CDD:238113 46/231 (20%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 45/226 (20%)
Tryp_SPc 83..268 CDD:304450 43/223 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.