DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG31266

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:254 Identity:71/254 - (27%)
Similarity:109/254 - (42%) Gaps:46/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRKV----LFVRIGEHNLNYE 566
            ::|||..|.:|.|||..:|.|.:....||..::...||||||.||..:    |.|..|  .:::.
  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTG--TVDWW 113

  Fly   567 DGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNV------- 624
            |.......|.:.:.|.||||....:|:|||:|...:.             |..:.||:       
  Fly   114 DLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIE-------------FNDVTKNITLADIDE 165

  Fly   625 -----DCTIIGWGKRRNRDATGT--SVLHKATVPIIPMQNCR-KVYYDYTITKNMFCAGHQKGHI 681
                 ..|..|||   :.:|.||  ..|.:|:...:|:..|| |:.....:.....|.....|. 
  Fly   166 LEEGDKLTFAGWG---SSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQ- 226

  Fly   682 DTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVVN 740
            ..|.||:||||:       :....:.||.::|..|. |....:||:...|.||:.:.:|
  Fly   227 GACHGDTGGPLI-------DEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIRTTMN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 69/247 (28%)
Tryp_SPc 507..735 CDD:238113 69/246 (28%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 69/247 (28%)
Tryp_SPc 52..275 CDD:238113 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.