DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG3916

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:296 Identity:75/296 - (25%)
Similarity:133/296 - (44%) Gaps:73/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 LKLSCG--IVRSGTG---RRSMSNMLKIIGGRAA-------------RKGEWPWQVAILNRFKEA 531
            |:|.|.  |:|.|..   ..:..:..:|.||:..             |:|.|           :.
  Fly     4 LQLFCMLLILRQGLADVVTSTTESPTRINGGQRVNETVPFQVSLQMQRRGRW-----------QH 57

  Fly   532 FCGGTLIAPRWVLTAAHCVRKV----LFVRIGEHNLNYEDGTEIQLRVMKSYTHPNFDKR-TVDS 591
            ||||::::.:.|||||||:.|:    :.|.:|  .||::.| .::.|::..:.||.:... .:.:
  Fly    58 FCGGSIVSGQHVLTAAHCMEKMKVEDVSVVVG--TLNWKAG-GLRHRLVTKHVHPQYSMNPRIIN 119

  Fly   592 DVALL------RLPKAVNATTWIGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATV 650
            |:||:      ||.::..:|..||.|      ..:.:.|...:.|||      :|..|. ..||:
  Fly   120 DIALVKVTPPFRLERSDISTILIGGS------DRIGEKVPVRLTGWG------STSPST-SSATL 171

  Fly   651 P---------IIPMQNCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTI 706
            |         .|..::|.:  ..:.:|:|..||...:|. ..|.|||||||:     :|.....:
  Fly   172 PDQLQALNYRTISNEDCNQ--KGFRVTRNEICALAVQGQ-GACVGDSGGPLI-----RPGKQPHL 228

  Fly   707 FGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVVNCD 742
            .||.|:|.....:.:..:|.:|.:::.::..|:|.|
  Fly   229 VGIVSYGSSTCAQGRPDVYTRVSSFLPYISQVINQD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 66/261 (25%)
Tryp_SPc 507..735 CDD:238113 66/260 (25%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 66/261 (25%)
Tryp_SPc 31..260 CDD:238113 66/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.