DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG17404

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:248 Identity:74/248 - (29%)
Similarity:112/248 - (45%) Gaps:30/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 KIIGGRAARKGEW-PWQVAILNRFKEA---FCGGTLIAPRWVLTAAHCVRKV----LFVRIGEHN 562
            :|:||.....||. |:||::..|.:..   ||||::|||..:||||||.:.:    :.|..|...
  Fly    34 RIVGGADIPPGEHVPYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHCCQGLNASRMSVVAGIRG 98

  Fly   563 LNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRL--PKAVNATTWIGYSCLPQPFQALPKNVD 625
            || |.|:..|  |:....||.: :..|.||:|:|.:  |..:|.:|........|....:...|.
  Fly    99 LN-EKGSRSQ--VLSYSIHPKY-QELVTSDLAVLSIKPPLKLNNSTISAIEYRSQGKDFVGGGVP 159

  Fly   626 CTIIGWGKRRN------RDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNMFCA-GHQKGHIDT 683
            .|:.|||.|..      .:....:||.:.:...|....||....: ::|....|| |..:|   .
  Fly   160 VTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNSECRNAGME-SVTDTEICARGPFRG---A 220

  Fly   684 CAGDSGGPLLCRDTTKPNHPWTIFGITSFG-DGCAQRNKFGIYAKVPNYVDWV 735
            |:|||||||:.........    .||.|:| ..|.......:|.:|..:.||:
  Fly   221 CSGDSGGPLVMESKNGLQQ----VGIVSYGLVVCGLYISPDVYTRVSTFSDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 73/246 (30%)
Tryp_SPc 507..735 CDD:238113 73/245 (30%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 73/246 (30%)
Tryp_SPc 35..269 CDD:238113 73/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.