DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and Sp7

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:372 Identity:96/372 - (25%)
Similarity:154/372 - (41%) Gaps:82/372 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 TTRRYKKCRIMDQCGREVLREIAYCYTEGSFCQQWLQTQFQKTPAFETRPGSGSPANAMRRMQSE 459
            |..|..:|  :|..||:   ....|.::.||..|            |....:..|.......:.:
  Fly    65 TFLRNSQC--LDGVGRQ---PYVCCTSDRSFGSQ------------EATSAAPPPTTTSSSSRGQ 112

  Fly   460 QPEVSMNDLNYIMTGKGYRGPEYTPLKLSCGIVRSGTGRRSMSNMLKIIGGRAARKGEWPWQVAI 524
            ..:..:.:|              .|....|       |..|.||  |:..|......|:.| :|:
  Fly   113 DGQAGLGNL--------------LPSPPKC-------GPHSFSN--KVYNGNDTAIDEFNW-MAL 153

  Fly   525 L----NR-FKEAFCGGTLIAPRWVLTAAHC--------VRKVLFVRIGEHNLNYE--------DG 568
            |    || .:|..|||:||..|:|||||||        |..:..||:||::.:.:        :.
  Fly   154 LEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLGEYDTSKDVDCIDDICNQ 218

  Fly   569 TEIQLRVMKSYTHPNFDKRTVD--SDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVD--CTII 629
            ..:||.:.::..||.:|....:  .|:|||||.:.|....:|...|||.....:..|..  ..:.
  Fly   219 PILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVS 283

  Fly   630 GWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNM------FCAGHQKGHIDTCAGDS 688
            |||  |...|..:::..:..:|:.....|.:.:    .|:|:      .|.|.: .:.|:|.|||
  Fly   284 GWG--RTTTARKSTIKQRLDLPVNDHDYCARKF----ATRNIHLISSQLCVGGE-FYRDSCDGDS 341

  Fly   689 GGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWV 735
            ||||:.|..   :..|...|:.|||:.|......|:|.:|.:|:||:
  Fly   342 GGPLMRRGF---DQAWYQEGVVSFGNRCGLEGWPGVYTRVADYMDWI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 76/259 (29%)
Tryp_SPc 507..735 CDD:238113 75/258 (29%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855 6/23 (26%)
Tryp_SPc 136..385 CDD:214473 76/259 (29%)
Tryp_SPc 137..388 CDD:238113 76/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.