DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG6865

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:263 Identity:88/263 - (33%)
Similarity:133/263 - (50%) Gaps:38/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRKVL--FVR-------IGEH 561
            ||:||..|.:.|.|:.|:::.|... |||||:|:.||:|||.||:...|  |::       :|.|
  Fly    34 KIVGGSEAERNEMPYMVSLMRRGGH-FCGGTIISERWILTAGHCICNGLQQFMKPAQIQGVVGLH 97

  Fly   562 NL--------NYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCL--PQP 616
            ::        |..|...:..:  ....||.:|...|..|:|||.|.:.:..::.|..||:  .:.
  Fly    98 SIREYLNGIGNGPDALRVDFK--NIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEG 160

  Fly   617 FQALPKNVDCTIIGWGKRRNRDATG--TSVLHKATVPIIPMQNCRKVYYDY----TITKNMFCAG 675
            .::|.:... |:.|||......|..  :.||.||||.|...:.|.:.|...    ||.:...|||
  Fly   161 HRSLEQEYG-TVSGWGWTHENQAENDRSDVLRKATVKIWNNEACERSYRSLGKSNTIGETQLCAG 224

  Fly   676 HQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVVN 740
            ::.|.||:|..||||||:    :|.:|   :.|:.|.|.|||:....|||.:|..||.|:..|: 
  Fly   225 YENGQIDSCWADSGGPLM----SKEHH---LVGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVI- 281

  Fly   741 CDG 743
             ||
  Fly   282 -DG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 84/253 (33%)
Tryp_SPc 507..735 CDD:238113 83/252 (33%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 84/252 (33%)
Tryp_SPc 35..280 CDD:238113 84/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.