DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG4914

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:251 Identity:92/251 - (36%)
Similarity:137/251 - (54%) Gaps:20/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRKVLF----VRIGEHN-LNY 565
            :|:||......|:|| :|.|:.|...:||||||..|:||||||||:..::    |..|||: .|.
  Fly   127 RIVGGTTTGVSEYPW-MARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCND 190

  Fly   566 EDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDCTII- 629
            ::..|.:. |:::::. .|.....|:|:|||||...|..|::|...|||:..|.....|....| 
  Fly   191 KERPETRF-VLRAFSQ-KFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIA 253

  Fly   630 -GWGKRRNRDATGTSVLHKATVPIIPMQNC--RKVYYDYTITKNMFCAGHQ-KGHIDTCAGDSGG 690
             |||..: .|...:.:|.:..||::....|  :..|....|||||.|:|:. .|..|:|.|||||
  Fly   254 TGWGTLK-EDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGG 317

  Fly   691 PLLCRDTTKPNHP-WTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVVNCDGNC 745
            ||:   ..:|:.. :...||.|:|:|||:.|..|:|.:|..|:||:  |.|....|
  Fly   318 PLV---RLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI--VENSRDGC 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 88/239 (37%)
Tryp_SPc 507..735 CDD:238113 88/238 (37%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 88/239 (37%)
Tryp_SPc 128..363 CDD:238113 90/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.