DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG4477

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:268 Identity:63/268 - (23%)
Similarity:105/268 - (39%) Gaps:75/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 SMSNMLKIIGGRAARK--GEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCV---RKVLFVRIG 559
            ::||....:..|:|.|  |:            ..||.|.::||.:|:|:|||:   |:||   |.
  Fly    49 ALSNYCVSLRSRSAEKFFGD------------NHFCSGVILAPMFVMTSAHCLINKRRVL---IS 98

  Fly   560 EHNLNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCL--PQPFQALPK 622
            ...|....||..:|:.:     ||   ||..:.|..:.||.:........:..|  ..||   |:
  Fly    99 SRVLLIVAGTLNRLKYI-----PN---RTFVTPVTHIWLPDSFTMRNKQDFGLLKVKNPF---PR 152

  Fly   623 N-----------------VDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKN 670
            |                 :.|.::|||:........:.:|: ..|.:|..:.|.|  :....:..
  Fly   153 NNEHISIARLPVHPPLPGLKCKVMGWGRMYKGGPLASYMLY-IDVQVIDSEACAK--WLRVPSVE 214

  Fly   671 MFCAGHQKGHIDT--------CAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAK 727
            ..||      :|:        |.||.|.|:|        |..|::||.:...||...:...:|..
  Fly   215 HVCA------VDSDDLTAQQPCGGDWGAPML--------HNGTVYGIVTILAGCGVSHLPSLYTN 265

  Fly   728 VPNYVDWV 735
            |.:..:|:
  Fly   266 VHSNANWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 60/260 (23%)
Tryp_SPc 507..735 CDD:238113 60/259 (23%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 61/262 (23%)
Tryp_SPc 55..273 CDD:214473 60/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.