DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG14990

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:314 Identity:83/314 - (26%)
Similarity:127/314 - (40%) Gaps:65/314 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 GSPA--NAMRRMQSEQPEVSMNDLNYIMTGKGYRGPEYTPLKLSCGIVRSGTGRRSMSNMLKIIG 509
            |:|.  |.|...::.||     |.|.:                 ||          |||...::.
  Fly    26 GAPGIFNGMSFTENLQP-----DPNQV-----------------CG----------MSNPNGLVA 58

  Fly   510 GRAARK-----GEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCV----RKVLFVRIGEHN--- 562
            .....|     |::||.||:.::.| .|..|:||||..|||||..|    ...:.||.||.|   
  Fly    59 NVKVPKDYSTPGQFPWVVALFSQGK-YFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQ 122

  Fly   563 ----LNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKN 623
                |..||..     |.:...|..|......:::|||.|.......:.|...|||...::..:.
  Fly   123 RSEFLPSEDRP-----VARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQK 182

  Fly   624 VDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCR------KVYYDYTITKNMFCAGHQKGHID 682
             .|.:.||||....|...:::..|..:|:|....|:      ::...:.:..::.|||.:|...|
  Fly   183 -RCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGD 246

  Fly   683 TCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVW 736
             |.||.|..|.|.....|:. :...||.::|.||.:.|...:|..|..:.||::
  Fly   247 -CLGDGGSALFCPMEADPSR-YEQAGIVNWGIGCQEENVPAVYTNVEMFRDWIY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 69/250 (28%)
Tryp_SPc 507..735 CDD:238113 69/249 (28%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 69/241 (29%)
Tryp_SPc 67..297 CDD:214473 68/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.