DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG32271

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:244 Identity:76/244 - (31%)
Similarity:116/244 - (47%) Gaps:40/244 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAF-CGGTLIAPRWVLTAAHCVR-----KVLFV----RIGE 560
            :|:||........|:.|.:  |....| |||:|:.|:.|:||||||:     ::|.|    |:.|
  Fly    24 RIVGGVPVDIASVPYLVNL--RIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRLTE 86

  Fly   561 HNLNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQA--LPKN 623
                    |.::..|.|.||...::.||:.||||:|:|...::.............|:|  |.| 
  Fly    87 --------TGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKVSTIELCNTSFKAGDLIK- 142

  Fly   624 VDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVY-YDYTITKNMFCAGHQKGHIDTCAGD 687
                :.|||:...|:...:..:....|.:||.:.|...| ...|||..||||. ..|..|.|.||
  Fly   143 ----VSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS-VPGVKDACEGD 202

  Fly   688 SGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVP---NYVD 733
            ||||.:        :...:.||.|:|.|||:::..|:|..|.   :::|
  Fly   203 SGGPAV--------YQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFID 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 76/244 (31%)
Tryp_SPc 507..735 CDD:238113 76/243 (31%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 75/241 (31%)
Tryp_SPc 25..244 CDD:238113 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.