DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and KLKB1

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:478 Identity:132/478 - (27%)
Similarity:212/478 - (44%) Gaps:101/478 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 DSSVEGDVFQ---YEDFDL-----PD-----------------TMYADSQESEGEFRNITWMQPA 369
            |.....::||   :.|.|:     ||                 |.|.:..:.|.: ||:..::.:
Human   209 DCGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQ-RNVCLLKTS 272

  Fly   370 KDGI---ALRRRKVYSKWSRWT--KCSPK-CTTRRYKKCRIMDQCGREV----LREIAYCYTEGS 424
            :.|.   :..:....|.:|..|  :..|: |.::.|..   :|..|.|:    ::.:..|.   .
Human   273 ESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPG---VDFGGEELNVTFVKGVNVCQ---E 331

  Fly   425 FCQQWLQTQF------------QKTPAFETRPGSGSPANAMRRMQSEQPEVSMNDLNYIMTGKGY 477
            .|.:.::.||            :|...|......|||..                :.|     |.
Human   332 TCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTR----------------IAY-----GT 375

  Fly   478 RGPEYTPLKLSCGIVRSGTGRRSM---SNMLKIIGGRAARKGEWPWQVAILNRF--KEAFCGGTL 537
            :|.....|:| |     .||..|:   ....:|:||..:..|||||||::..:.  :...|||:|
Human   376 QGSSGYSLRL-C-----NTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSL 434

  Fly   538 IAPRWVLTAAHC-----VRKVLFVRIGEHNLNYEDGTEIQ--LRVMKSYTHPNFDKRTVDSDVAL 595
            |..:||||||||     ::.|.  ||....||..|.|:..  .::.:...|.|:.....:.|:||
Human   435 IGHQWVLTAAHCFDGLPLQDVW--RIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIAL 497

  Fly   596 LRLPKAVNATTWIGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRK 660
            ::|...:|.|.:....|||..........:|.:.|||..:.:... .::|.|..:|::..:.|:|
Human   498 IKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEI-QNILQKVNIPLVTNEECQK 561

  Fly   661 VYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIY 725
            .|.||.||:.|.|||:::|..|.|.|||||||:|    |.|..|.:.||||:|:|||:|.:.|:|
Human   562 RYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVC----KHNGMWRLVGITSWGEGCARREQPGVY 622

  Fly   726 AKVPNYVDWVW-SVVNCDGNCKM 747
            .||..|:||:. ...:.||..:|
Human   623 TKVAEYMDWILEKTQSSDGKAQM 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 88/237 (37%)
Tryp_SPc 507..735 CDD:238113 88/236 (37%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519 14/83 (17%)
APPLE 303..386 CDD:128519 19/110 (17%)
Tryp_SPc 401..632 CDD:214473 88/237 (37%)
Tryp_SPc 402..632 CDD:238113 88/236 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.