DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG3650

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:230 Identity:67/230 - (29%)
Similarity:110/230 - (47%) Gaps:25/230 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRKVLFVRI----GEHNLNYE 566
            :|:||...........|..|......:|||:|:....|:|||||::.....||    |...|: :
  Fly    25 RIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSSHVVTAAHCLKGYQASRITVQGGVSKLS-Q 88

  Fly   567 DGTEIQLRVMKSYTHPN-FDKRTVDSDVALLRLPKAVNATTWIGYSCLPQ-PFQALPKNVDCTII 629
            .|.   :|.:..|..|| |...:::.||.::||..|:   |..|.:.:|. ..|..|.|. ..:.
  Fly    89 SGV---VRRVARYFIPNGFSSSSLNWDVGVIRLQSAL---TGSGITTIPLCQVQWNPGNY-MRVS 146

  Fly   630 GWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDY-TITKNMFCAGHQKGHIDTCAGDSGGPLL 693
            |||..|..:::.::.|....:.:|..:.|::.|... |:|.:.|||  :.|..|:|:|||||.::
  Fly   147 GWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLTASTFCA--RTGGKDSCSGDSGGGVI 209

  Fly   694 CRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKV 728
            .::        .:.||.|:|.|||.....|:|..|
  Fly   210 FKN--------QLCGIVSWGLGCANAQYPGVYTSV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 67/230 (29%)
Tryp_SPc 507..735 CDD:238113 67/229 (29%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 67/230 (29%)
Tryp_SPc 26..243 CDD:238113 67/229 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455727
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.