DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG32270

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:268 Identity:84/268 - (31%)
Similarity:118/268 - (44%) Gaps:62/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 RRSMSNML------KIIGGRAARKGEWPWQVAILNR--FKEAFCGGTLIAPRWVLTAAHCVR--- 551
            |.|::..|      :|:||..:.....|..|.|..|  |:   |||:|:.||.|||||||:.   
  Fly    16 RESVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFE---CGGSLVTPRCVLTAAHCLNDGN 77

  Fly   552 -KVLFVRIGEHNLNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQ 615
             ....||.|   :.|.........|.|......:.:.|:|.|||||:               |.|
  Fly    78 PSDFVVRGG---VTYLSDMRNSRYVRKILMPSAYSRTTLDHDVALLQ---------------LKQ 124

  Fly   616 PFQA-LPKNVDCT-----------IIGWGKRRNRDATGTSV---LHKATVPIIPMQNCRKVYYDY 665
            |.|| :.|.:...           :.|||.   .|::.||:   |....|.::|.:.||.:|..|
  Fly   125 PLQASIAKPISLAVRSPRPGSFVRVSGWGL---TDSSSTSLPNQLQSVHVQVMPQRECRDLYRGY 186

  Fly   666 -TITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDG--CAQRNKFGIYAK 727
             .||.:||||. ..|..|.||||||||::       |....:.|:.|:|..  ||.|:..|:|:.
  Fly   187 RNITSSMFCAS-VPGLKDACAGDSGGPVV-------NSNGILVGVVSWGRAHRCAARDSPGVYSD 243

  Fly   728 VPNYVDWV 735
            |....||:
  Fly   244 VSYLSDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 80/252 (32%)
Tryp_SPc 507..735 CDD:238113 80/251 (32%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 80/252 (32%)
Tryp_SPc 31..254 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455713
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.