DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG30414

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:323 Identity:82/323 - (25%)
Similarity:122/323 - (37%) Gaps:97/323 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 IMTGKGYRG-----------PEYTPLKLSCGIVRSGTGRRSMSNMLKIIGGRAARKGEWPWQVAI 524
            |..|:|..|           ||:.|:                     |.||..|.....||.|.:
  Fly    15 IQLGEGAPGHLLDSSCGTTKPEFIPM---------------------ITGGADAGLFSNPWMVKV 58

  Fly   525 LNRFKEAFCGGTLIAPRWVLTAAHCVRKV-LFVRIGEHNLNYEDGTEIQLRVMKSY--------- 579
            |.   |..|||:||..|:|||||||:... :.||:||:...: .|.:....|.|||         
  Fly    59 LG---EKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRF-PGKDCSRCVPKSYKLRRIRLGE 119

  Fly   580 ------------------------THPNFDKRTVDSDVALLRLPKAVNATTWIGYSCL------- 613
                                    .|.::: ..:|:|:.|||:...|..:.::...||       
  Fly   120 YDTRFPGKDCCVPKSYELAVDRKILHADYN-LNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMA 183

  Fly   614 PQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQK 678
            ..|.        ..|.|||.  ..|.|.:..|.:|||....:..||. .:...:.::..||....
  Fly   184 ESPI--------FNITGWGV--TNDGTPSRRLQRATVYNTDLHFCRS-KFTKQVDESQICAAGTN 237

  Fly   679 GHIDTCAGDSGGPLLCRDTTKPNHPWTIF--GITSFGDGCAQRNKFGIYAKVPNYVDWVWSVV 739
            .  |.|.|||||||..:.....:  |..|  |:.|:|.  |..:.|.:|..|.::.||:.:.:
  Fly   238 S--DACHGDSGGPLSAQVPFAGS--WLTFQYGLVSYGS--AACHSFSVYTNVTHHRDWIVNAI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 74/271 (27%)
Tryp_SPc 507..735 CDD:238113 74/270 (27%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 74/270 (27%)
Tryp_SPc 41..290 CDD:238113 74/270 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.