DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG9294

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:275 Identity:95/275 - (34%)
Similarity:142/275 - (51%) Gaps:27/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 PLKLSCGIVRSGTGRRSMSNMLKIIGGRAARKGEWPWQVAIL--NRFKEAFCGGTLIAPRWVLTA 546
            |::..|...|.|.    ::.:.||:||:..|..::||...||  |||   :|.|:||...:||||
  Fly    82 PIERDCVTCRCGL----INTLYKIVGGQETRVHQYPWMAVILIYNRF---YCSGSLINDLYVLTA 139

  Fly   547 AHCVR----KVLFVRIGEHNLNY-EDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATT 606
            ||||.    :::.:|..|||.:: .|...||..|.:...|..::.|:.|:|:|:|||.:.::...
  Fly   140 AHCVEGVPPELITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRH 204

  Fly   607 W-IGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRK--VYYDYTIT 668
            . :...|||....:....:. .:.|||.:| ....||..|.:..|.::|...||.  .|....||
  Fly   205 HRLRPICLPVQSYSFDHELG-IVAGWGAQR-EGGFGTDTLREVDVVVLPQSECRNGTTYRPGQIT 267

  Fly   669 KNMFCAGH-QKGHIDTCAGDSGGPLLCRDTTKPNHP--WTIFGITSFGDGCAQRNKFGIYAKVPN 730
            .||.|||: .:|..|.|:|||||||   .||....|  :.:.||.|:|.|||:....|:|.:|..
  Fly   268 DNMMCAGYISEGGKDACSGDSGGPL---QTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQ 329

  Fly   731 YVDWVWSVVNCDGNC 745
            |:.|:.|  |..|.|
  Fly   330 YLRWLGS--NTPGGC 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 86/241 (36%)
Tryp_SPc 507..735 CDD:238113 85/240 (35%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 86/240 (36%)
Tryp_SPc 101..334 CDD:238113 85/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.