DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and tpr

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:302 Identity:91/302 - (30%)
Similarity:145/302 - (48%) Gaps:40/302 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 TRPGSGSPANAMRRMQSEQPEVSMNDLNYIMTGKGYRGPEYTPLKLSCGIVRSGTGRRSMSNMLK 506
            |.|...|.....||..:..|..    ||          |........|||          :|:.|
  Fly    85 TTPAPSSSTTTTRRATTPAPPT----LN----------PPRNCSDCVCGI----------ANIQK 125

  Fly   507 -IIGGRAARKGEWPWQVAIL--NRFKEAFCGGTLIAPRWVLTAAHCV----RKVLFVRIGEHNLN 564
             |:||:.....::||...:|  .||   :|..:|:..:::|||:|||    ::.:.||:.||:..
  Fly   126 RIVGGQETEVHQYPWVAMLLYGGRF---YCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRK 187

  Fly   565 YEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDCTII 629
            .....:|..:|.:..|||.::.|..|:|:|:::|.:.|.....:...|:|.|.::. |..:..:.
  Fly   188 MSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF-KGENGIVT 251

  Fly   630 GWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPL-L 693
            |||..:....| :..|.:..|||:....|||..|...||.||.|.|:.:|..|:|.||||||| :
  Fly   252 GWGALKVGGPT-SDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHI 315

  Fly   694 CRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWV 735
            ....|:.:.   |.|:.|:|:|||:....|:||:|..|..|:
  Fly   316 VASGTREHQ---IAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 77/236 (33%)
Tryp_SPc 507..735 CDD:238113 76/234 (32%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 76/235 (32%)
Tryp_SPc 127..356 CDD:238113 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.