DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and etaTry

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:239 Identity:69/239 - (28%)
Similarity:114/239 - (47%) Gaps:20/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEA-----FCGGTLIAPRWVLTAAHCV----RKVLFVRIGEH 561
            :|:||.........:.|.:..|...:     .|||.::....:.||||||    .:...|..|:.
  Fly    27 RIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYNREAENFLVVAGDD 91

  Fly   562 NLNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDC 626
            :....:|  :.:||.|...|..::..|:|:|:||:.:...:...::.....:....:.....|..
  Fly    92 SRGGMNG--VVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQA 154

  Fly   627 TIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGP 691
            ||.|||..: .:...:..|.:..|||:..:.|::.||...|::.|.|||..:|..|.|.||||||
  Fly   155 TISGWGYTK-ENGLSSDQLQQVKVPIVDSEKCQEAYYWRPISEGMLCAGLSEGGKDACQGDSGGP 218

  Fly   692 LLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWV 735
            |:..:        .:.||.|:|:|||:.|..|:||.|..|.||:
  Fly   219 LVVAN--------KLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 68/237 (29%)
Tryp_SPc 507..735 CDD:238113 68/236 (29%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 68/237 (29%)
Tryp_SPc 28..257 CDD:238113 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.