DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and SPH93

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:267 Identity:84/267 - (31%)
Similarity:126/267 - (47%) Gaps:29/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 LKLSCGIVRSGTGRRSMSNMLKIIGG---RAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTA 546
            |..|||:        |.:|.|:::.|   ..||..::||.|||.:. .:...||:||.|..|||.
  Fly   229 LSPSCGM--------SNANGLQMVEGITIDQARPAQYPWAVAIFHN-GQYLAGGSLIQPNVVLTV 284

  Fly   547 AHCVRKV---LFVRIGEHNLNYEDGTEI----QLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNA 604
            ||.|..:   |.||.|:.:|  :...||    |..|.::..|..||.::..:::|||.|......
  Fly   285 AHRVITIETELVVRAGDWDL--KSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKL 347

  Fly   605 TTWIGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYD----- 664
            ...|...|||.|.::.... .||:.||||.|..|...::||.|..:.::....|.|....     
  Fly   348 NDHIRTICLPTPNKSFAGR-RCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGA 411

  Fly   665 -YTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKV 728
             :.:.||:.|||.:.|. |||.||.|..|.|....:.:..:...||.::|.||.|.....||.:|
  Fly   412 KFELPKNIICAGGELGR-DTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEV 475

  Fly   729 PNYVDWV 735
            ..:.:|:
  Fly   476 SKFTNWI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 76/244 (31%)
Tryp_SPc 507..735 CDD:238113 76/243 (31%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 76/238 (32%)
Tryp_SPc 252..482 CDD:214473 75/234 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.