DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG4793

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:368 Identity:102/368 - (27%)
Similarity:150/368 - (40%) Gaps:76/368 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 KCTTRRYKKCRIMDQCGREVLREIAYCYTEGSFCQQWLQTQFQKTPAFETRPGSGSPANAMRRMQ 457
            :|..|  .:|||..:.||.:: :..........|:.. ||...||...:      .|..|     
  Fly    28 ECVQR--NRCRIGTETGRPII-DFRGLNNGNQGCESG-QTCCPKTEILQ------YPVQA----- 77

  Fly   458 SEQPEVSMNDLNYIMTGKGYRGPEYTPLKLSCGIV-RSGTGRRSMSNMLKIIGGRAARKGEWPWQ 521
                                   :..||...||.| |.|.| .:::|...|     |:|||.||.
  Fly    78 -----------------------DNQPLPTECGHVNRIGVG-FTITNARDI-----AQKGELPWM 113

  Fly   522 VAIL-NRFKEAFCGGTLIAPRWVLTAA----HCVRKVLFVRIGEHNLNYEDGTEIQ----LRVMK 577
            ||:| :|.:....||:||....|||::    ....|.|.||.||  .::|..||.:    :.:.|
  Fly   114 VALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGE--WDFESITEERAHEDVAIRK 176

  Fly   578 SYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGT 642
            ...|.|.......::.|||.|.:.:.....||..|||.|.:....| .|.:.||||:...|.:..
  Fly   177 IVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHN-RCIVSGWGKKTALDNSYM 240

  Fly   643 SVLHKATVPIIPMQNCRKVYY-----DYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNH 702
            ::|.|..:|::....|:....     |:.:..::.|||.:.|. |||.||.|.||.|...:.||.
  Fly   241 NILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGK-DTCKGDGGAPLACPLQSDPNR 304

  Fly   703 PWTIFGITSFGDGCAQRNKFG----IYAKVPNYVDWVWSVVNC 741
             :.:.||.:||.||.     |    .|..|.....|   :.||
  Fly   305 -YELLGIVNFGFGCG-----GPLPAAYTDVSQIRSW---IDNC 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 76/246 (31%)
Tryp_SPc 507..735 CDD:238113 76/245 (31%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 76/244 (31%)
Tryp_SPc 105..335 CDD:214473 76/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.