DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG18478

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:239 Identity:74/239 - (30%)
Similarity:120/239 - (50%) Gaps:24/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 ARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCV--RKV--LFVRIGEHNLNYEDGTEI-- 571
            |:..|:||.:|:::. :....||:||.|..||||||.:  :.|  :.|..||    :|.|:.:  
  Fly    50 AKPAEFPWTIAVIHN-RSLVGGGSLITPDIVLTAAHRIFNKDVEDIVVSAGE----WEYGSALEK 109

  Fly   572 ----QLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDCTIIGWG 632
                :..|:|...|.:|:.:...:::|||.|.:....|..|...|||...::| .:..|.:.|||
  Fly   110 YPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQKRSL-SSTRCIVAGWG 173

  Fly   633 KRRNRDATGTSVLHKATVPIIPMQNCR------KVYYDYTITKNMFCAGHQKGHIDTCAGDSGGP 691
            |.:..|.....||.|..:||:|...|:      ::..:||:.:.:.|||.:|.: |.|.||.||.
  Fly   174 KYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGEKDN-DACTGDGGGA 237

  Fly   692 LLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWV 735
            |.|..|..|.. :...||.::|.||.::|....|..|..:..|:
  Fly   238 LFCPMTEDPKQ-FEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 73/237 (31%)
Tryp_SPc 507..735 CDD:238113 73/237 (31%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 74/239 (31%)
Tryp_SPc 50..280 CDD:214473 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.