DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG18557

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:277 Identity:73/277 - (26%)
Similarity:117/277 - (42%) Gaps:35/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 LSCGIVRSGTGRRSMSNMLKIIGGRA------ARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLT 545
            |:||        :|..|.|   ||..      |:..|:||.||::......|..|||:....|:|
  Fly    69 LNCG--------KSNPNGL---GGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVIT 122

  Fly   546 AAHCVRKVLF----VRIGEHNLNYEDGTEIQLR-VMKSYTHPNFDKRTVDSDVALLRLPKAVNAT 605
            |||.:.....    :..|..:|....|..||.| ..:..:||:|:|.|..:::||:.|..:....
  Fly   123 AAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMK 187

  Fly   606 TWIGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKV------YYD 664
            ..||..|.|....:..:. .|.:.|||:........:....|..:||:...:|..:      ...
  Fly   188 PPIGPICWPTSGVSFDRE-RCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQS 251

  Fly   665 YTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHP--WTIFGITSFGDGCAQRNKFGIYAK 727
            :.:...:.|||.::|. |.|.||.|.||:|   ..|.||  :.:.||.:.|..|...|...:|..
  Fly   252 FQLDPTILCAGGERGR-DACIGDGGSPLMC---PIPGHPAIYELVGIVNSGFSCGLENVPALYTN 312

  Fly   728 VPNYVDWVWSVVNCDGN 744
            :.:...|:...:|.:.|
  Fly   313 ISHMRPWIEKQLNDELN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 64/247 (26%)
Tryp_SPc 507..735 CDD:238113 64/246 (26%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 63/239 (26%)
Tryp_SPc 90..320 CDD:214473 62/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.