DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG31267

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:272 Identity:62/272 - (22%)
Similarity:110/272 - (40%) Gaps:59/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 RSGTGRRSMSNMLKIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRKVLFVR 557
            :|.|..:..|   :|:||..:.....|:.|::.|.:...||.|::|..:||:|||.|:..:....
  Fly    34 KSETANKFSS---RIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNN 95

  Fly   558 IGEHNLNYED-GTE-----IQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQ- 615
            :......|.. |:|     ::..||    |.|||.....:|:||::      ......|..:.| 
  Fly    96 VQVVTTTYNHWGSEGWIYSVEDIVM----HCNFDSPMYHNDIALIK------THALFDYDDVTQN 150

  Fly   616 ----PFQALPKNVDCTIIGWGKRRNRDATGTSV-------LHKATVPIIPMQNCRKVY---YDYT 666
                |.:.|......|:.|:|        .|.:       |.:..|..:..:.|...|   .|..
  Fly   151 ITIAPLEDLTDGETLTMYGYG--------STEIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLD 207

  Fly   667 ITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFG---IYAKV 728
            :  ...||..:.| ...|.||:|||::       :....:.|:.::|..|.    :|   ::|::
  Fly   208 V--GHLCAVGKVG-AGACHGDTGGPIV-------DSRGRLVGVGNWGVPCG----YGFPDVFARI 258

  Fly   729 PNYVDWVWSVVN 740
            ..|..|:.|.:|
  Fly   259 SFYYSWIISTIN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 56/252 (22%)
Tryp_SPc 507..735 CDD:238113 56/251 (22%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 56/252 (22%)
Tryp_SPc 45..268 CDD:238113 57/254 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.