DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG3795

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:317 Identity:78/317 - (24%)
Similarity:130/317 - (41%) Gaps:82/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 ETRPGSGSPANAMRRMQSEQPEVSMNDLNYIMTGKGYRGPEYTPLKLSCGIVRSGTGRRSMSNML 505
            |::.|....|.:.|:   ::|    :|..:::|| ||| |:...|......:|.|..::...:  
  Fly    22 ESQAGQLHSAPSQRQ---DRP----SDFQFLVTG-GYR-PDTNDLVKYTVSLRMGKPKKFFGD-- 75

  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCV---------RKVLFVRIGEH 561
                                    ..||.||:.:.|.:||||||:         :|::.|.....
  Fly    76 ------------------------NHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPR 116

  Fly   562 NLNYEDGTEIQLRVMKSYTHPNFDK-RTVDSDVALLRLPKAVNATTWIGYSCLPQP-FQALP-KN 623
            .|.....|:| :...:...||.:.| ::...|:.|:.|    .|...:|.:....| :..:| ..
  Fly   117 RLLKSSTTQI-IEAEELLPHPKYKKGKSQKYDIGLILL----EADLSLGDAVAKIPLYNKVPVAG 176

  Fly   624 VDCTIIGWGKRRNRDATGTSVLHKATVP---------IIPMQNCRKVYYDYTITKNMFCAGHQ-K 678
            ..|:|:|||          :|:....:|         |:|...|.|:.  ......|.||..: .
  Fly   177 APCSIVGWG----------TVIQFGPLPDEAINGDMQILPDTFCEKLL--GWSNAGMLCANDKHD 229

  Fly   679 GHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWV 735
            ..:|:|.|||||||:|.:        .:.||.|||.||.:.:..|||..|.::.||:
  Fly   230 SDVDSCQGDSGGPLICDN--------MVTGIVSFGMGCGEPDSAGIYTDVYHFRDWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 62/250 (25%)
Tryp_SPc 507..735 CDD:238113 62/249 (25%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 65/270 (24%)
Tryp_SPc 60..278 CDD:214473 64/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.