DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG30289

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:309 Identity:79/309 - (25%)
Similarity:136/309 - (44%) Gaps:77/309 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 NAMRRMQSEQPEVSMNDLNYIMTGKGYRGPEYTPLKLSCGIVRSGTGRRSMSNMLKIIGGRAARK 515
            |.|.|:..|...:|.:|             .|.|                     .|.||.....
  Fly    20 NVMSRLLVENCGISKDD-------------PYVP---------------------NIFGGAKTNI 50

  Fly   516 GEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVR-KVLFVRIGEHN--------LN------- 564
            .|.||.|.:   :....|||:|||.::||||||||. :.|:||:|::.        ||       
  Fly    51 QENPWMVLV---WSSKPCGGSLIARQFVLTAAHCVSFEDLYVRLGDYETLDPMPYCLNNHCIPKF 112

  Fly   565 YEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCL--PQPFQALPKNVDCT 627
            |....::::      .|.|::..|:.:|:||||:.:||..:.::...||  .:..|::|.   .|
  Fly   113 YNISVDMKI------VHENYNGITLQNDIALLRMSEAVEYSDYVRPICLLVGEQMQSIPM---FT 168

  Fly   628 IIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPL 692
            :.|||:  ......:.:|..||:..:.:..| .:.::....::..|||....  :||.|||||||
  Fly   169 VTGWGE--TEYGQFSRILLNATLYNMDISYC-NIKFNKQADRSQICAGSHTS--NTCKGDSGGPL 228

  Fly   693 LCRDTTKPNHPWTI----FGITSFGDGCAQRNKFGIYAKVPNYVDWVWS 737
                ::|.::...:    :|:.|:|......|..|:|..|..:.:|:::
  Fly   229 ----SSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHREWIFN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 70/250 (28%)
Tryp_SPc 507..735 CDD:238113 70/249 (28%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 70/249 (28%)
Tryp_SPc 42..271 CDD:238113 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.