DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG30288

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:291 Identity:86/291 - (29%)
Similarity:124/291 - (42%) Gaps:68/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 LSCGIVRSGTGR-------RSMSN--MLKIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRW 542
            |..||:|:.:||       .:.||  ..:|.|||.|.....||.|.::...| |.|||:||..|:
  Fly    14 LFIGIIRTESGRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGK-AVCGGSLITARF 77

  Fly   543 VLTAAHCVRKV-LFVRIGEHNLNYEDGTEIQLRVMKSYTHPNF----------------DKRTVD 590
            ||||.||:..: :.||:||::..                ||.|                |::.|.
  Fly    78 VLTAEHCISPMYMNVRLGEYDTR----------------HPIFDCDDFVCTPRAYNVDVDRKIVH 126

  Fly   591 S----DVALLRLPKAVNATTWIGYSCL-------PQPFQALPKNVDCTIIGWGKRRNRDATGTSV 644
            |    |:.|||:.::|..:.::...||       ..|...|..|    ..|||  .|.|......
  Fly   127 SNPGYDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFN----FTGWG--TNSDGEEQDR 185

  Fly   645 LHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQKGHI-DTCAGDSGGPLLCRDTTKPNHPWTIFG 708
            |..||:..:|..:|.:......|  :..|||   .:| |:|.|||||||....|.:.......||
  Fly   186 LQTATLQQLPQWSCERPGRPLDI--SYICAG---SYISDSCKGDSGGPLSAIRTFEGQGRVFQFG 245

  Fly   709 ITSFGDGCAQRNKFGIYAKVPNYVDWVWSVV 739
            :.|  .|....:..|||..|.::.||:..|:
  Fly   246 VAS--QGLRLCSGLGIYTNVTHFTDWILDVI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 76/257 (30%)
Tryp_SPc 507..735 CDD:238113 76/256 (30%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 76/257 (30%)
Tryp_SPc 45..270 CDD:238113 75/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.