DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG30287

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:261 Identity:79/261 - (30%)
Similarity:122/261 - (46%) Gaps:41/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   499 RSMSNMLKIIGGRAARKGEWPWQVAILNR--FKEAFCGGTLIAPRWVLTAAHC---VRKVLFVRI 558
            ||...:.::|.|:.|.....||.|.|:.|  .|   |||:||.||:|||||||   .:..|.||:
  Fly    34 RSEPGLYRVINGKPADLFSNPWMVIIIERGMMK---CGGSLITPRYVLTAAHCKSETKSQLTVRL 95

  Fly   559 GEHNLNYE-DGTEI-------QLRVMKSYT---HPNFDKRTVDSDVALLRLPKAVNATTWIGYSC 612
            |::::|.. |.:..       ::.|.::|.   :.||.|    :|:|||||...|.....|...|
  Fly    96 GDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRK----NDIALLRLETTVQYGDNIRSIC 156

  Fly   613 LPQPFQALPKNVDCTII-----GWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNMF 672
            |.........|:...::     |||:..:|  ..:.||.:|::....:..|.:| :...:.|:..
  Fly   157 LLMGDYTWSSNILKNLVKFNTTGWGRTESR--INSPVLQQASLTHHHLSYCAQV-FGKQLDKSHI 218

  Fly   673 CAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGD-GCAQRNKFG--IYAKVPNYVDW 734
            |.....|  .||.|||||||..|..........:||:.|:|. .|     ||  :|..|.::.:|
  Fly   219 CVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC-----FGPTVYTNVIHFANW 276

  Fly   735 V 735
            :
  Fly   277 I 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 76/252 (30%)
Tryp_SPc 507..735 CDD:238113 76/251 (30%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 76/252 (30%)
Tryp_SPc 42..280 CDD:238113 77/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.