DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG30088

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:269 Identity:88/269 - (32%)
Similarity:130/269 - (48%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 SCGIVRSGTGRRSMSNM-LKIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVR 551
            |||:...       ||: .:|:.|:.|.....|: :|.|....|..||||:|:.|::||||||:|
  Fly    32 SCGVSYE-------SNVATRIVRGKEAMLKSAPF-MAYLYYSSEIHCGGTIISSRYILTAAHCMR 88

  Fly   552 KVLFVRIGEHNLNYEDGTE--------IQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWI 608
            ..|.||:|||::......:        .:..::.:..:..|| |.:.:|:|||:|.:.:.....|
  Fly    89 PYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD-RFLANDIALLKLSRNIRFNVHI 152

  Fly   609 GYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNMFC 673
            ...||.....|.|...:....|||:.....:  .:||....:.....::||.| ....||.|..|
  Fly   153 QPICLILNPAAAPNVHEFQAFGWGQTETNHS--ANVLQTTVLTRYDNRHCRSV-LSMPITINQLC 214

  Fly   674 AGHQKGHIDTCAGDSGGPLLCRDTTKPNHP--WTI--FGITSFGDGCAQRNKFGIYAKVPNYVDW 734
            .|.|..  |||:|||||||:    ||.|:.  |..  .||.||||...|..  |:|..||||:.|
  Fly   215 VGFQGS--DTCSGDSGGPLV----TKVNYDGVWRYLQLGIVSFGDDKCQSP--GVYTYVPNYIRW 271

  Fly   735 VWSVVNCDG 743
            :..|:..:|
  Fly   272 IRYVMQSNG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 80/240 (33%)
Tryp_SPc 507..735 CDD:238113 80/239 (33%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 80/240 (33%)
Tryp_SPc 45..273 CDD:238113 81/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.