DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CG30083

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:252 Identity:79/252 - (31%)
Similarity:119/252 - (47%) Gaps:41/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 KIIGGRAARKGEWPWQVAILNRFK-------EAFCGGTLIAPRWVLTAAHCVRK--VLFVRIGEH 561
            ||:.|:.|..|..||...|   ||       |..||||||..::||:||||:::  :|.||:|||
  Fly    33 KIMHGQNAENGTNPWMAYI---FKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILAVRLGEH 94

  Fly   562 NLNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDC 626
            :      :.....|.|::.:..|...:..:|:.:||:...|.....|...|:......:|.....
  Fly    95 S------SSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTF 153

  Fly   627 TIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGP 691
            ...||||..|.  |.:.||....:..:....|..:.: ..:|::..||||..|  ||||||||||
  Fly   154 KAAGWGKTENE--TFSKVLKTVELNELNASECYNMLW-VNVTESQICAGHPDG--DTCAGDSGGP 213

  Fly   692 LLCRDTTKPNHP--------WTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVVN 740
            |:        ||        :...||.|||....  |..|:|.::.:::||:..||:
  Fly   214 LI--------HPVYMDGSLRYVQLGIISFGSSLC--NSPGVYTRLSSFIDWILMVVD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 76/245 (31%)
Tryp_SPc 507..735 CDD:238113 75/244 (31%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 76/245 (31%)
Tryp_SPc 34..255 CDD:238113 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.