DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and PRSS55

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:297 Identity:102/297 - (34%)
Similarity:147/297 - (49%) Gaps:27/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 PEVSMNDLNYIMTGKGYRG-----PEYTPLKLS-CGIVRSGTGRRSMSNMLKIIGGRAARKGEWP 519
            |...:.:....:.|:. ||     |.:.|..:| ||......||...|   :|.||..|..||:|
Human    20 PRTPLPEAGVAILGRA-RGAHRPQPPHPPSPVSECGDRSIFEGRTRYS---RITGGMEAEVGEFP 80

  Fly   520 WQVAILNRFKEAFCGGTLIAPRWVLTAAHCV------RKVLFVRIGEHNLNYEDGTEIQLRVMKS 578
            |||:|..| .|.||||:::...|:||||||:      .:.|.|.:|.::|. ....||: .|...
Human    81 WQVSIQAR-SEPFCGGSILNKWWILTAAHCLYSEELFPEELSVVLGTNDLT-SPSMEIK-EVASI 142

  Fly   579 YTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLP-QPFQALPKNVDCTIIGWGKRRNRDATGT 642
            ..|.:|.:..:|:|:|||.|...:.........||| ||..|..:  :|.:.|||:....|....
Human   143 ILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQPGPATWR--ECWVAGWGQTNAADKNSV 205

  Fly   643 SV-LHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTI 706
            .. |.||.:.|:..:.|.|::  ..:||||.|||::....|.|.|||||||:|  |.:|...|..
Human   206 KTDLMKAPMVIMDWEECSKMF--PKLTKNMLCAGYKNESYDACKGDSGGPLVC--TPEPGEKWYQ 266

  Fly   707 FGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVVNCDG 743
            .||.|:|..|.::|..|||..:.||..|:..|...:|
Human   267 VGIISWGKSCGEKNTPGIYTSLVNYNLWIEKVTQLEG 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 87/236 (37%)
Tryp_SPc 507..735 CDD:238113 87/235 (37%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 87/236 (37%)
Tryp_SPc 68..298 CDD:238113 88/238 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.