DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and CELA3A

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_005738.4 Gene:CELA3A / 10136 HGNCID:15944 Length:270 Species:Homo sapiens


Alignment Length:259 Identity:86/259 - (33%)
Similarity:135/259 - (52%) Gaps:24/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 VRSGTGRRSMSNMLKIIGGRAARKGEWPWQVAILNRFKEAF---CGGTLIAPRWVLTAAHCVRKV 553
            |.||.|..|..:..:::.|..|....|||||::......:|   |||:||||.||:||.||:.:.
Human    14 VASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRD 78

  Fly   554 LF--VRIGEHNLNYEDGTE--IQLRVMKSYTHPNFDKRTV--DSDVALLRLPKAVNATTWIGYSC 612
            |.  |.:||:||..::|.|  |.:...:.:.||.:::..|  .:|:||::|.::......:..:.
Human    79 LTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLAS 143

  Fly   613 LPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNC-RKVYYDYTITKNMFCAGH 676
            ||.....||....|.|.||| |...:......|.:|.:|::..::| |..::..|:.|.|.||| 
Human   144 LPPAGDILPNKTPCYITGWG-RLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAG- 206

  Fly   677 QKGHIDT-CAGDSGGPLLCRDTTKPNHP--WTIFGITSF--GDGCAQRNKFGIYAKVPNYVDWV 735
              |:|.: |.|||||||.|     |...  |.:.|:|||  ..||....|..::.:|..::||:
Human   207 --GYIRSGCNGDSGGPLNC-----PTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 80/243 (33%)
Tryp_SPc 507..735 CDD:238113 80/242 (33%)
CELA3ANP_005738.4 Tryp_SPc 28..263 CDD:214473 80/243 (33%)
Tryp_SPc 29..266 CDD:238113 81/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.