DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10663 and LOC100498532

DIOPT Version :9

Sequence 1:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001333498.1 Gene:LOC100498532 / 100498532 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:240 Identity:82/240 - (34%)
Similarity:126/240 - (52%) Gaps:23/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVR--KVLFVRIGEHNLNYEDG 568
            ||:||........|||| :.......:|||:||:|||:::||||.:  |.|...:|||:|..::|
 Frog    24 KIVGGYECTPHSQPWQV-LFTYNGGNWCGGSLISPRWIISAAHCYQPPKTLVALLGEHDLKKKEG 87

  Fly   569 TEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPF---QALPKN-VDCTII 629
            ||..::|..:|.|..:..:..|.|:.|::|.|...      |:...||.   ::.|.: ..|.:.
 Frog    88 TEQHIQVEAAYKHFGYKDKAHDHDIMLVKLAKPAQ------YNQYVQPIPVARSCPTDGAKCLVS 146

  Fly   630 GWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLC 694
            |:|.....:......|....|||:...:| |..|...|::||||||..:|...:|.|||||||:|
 Frog   147 GFGNVLGYNVRYPDQLQCLEVPIVSDSSC-KASYPRMISENMFCAGFLEGGKGSCHGDSGGPLIC 210

  Fly   695 RDTTKPNHPWTIFGITSFGDG-CAQRNKFGIYAKVPNYVDWVWSV 738
            ..        .::|..|:|.. |..:|..|:||||.||:||:.::
 Frog   211 NG--------ELYGAVSWGGSYCISKNSPGVYAKVCNYLDWIKNI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 81/235 (34%)
Tryp_SPc 507..735 CDD:238113 80/234 (34%)
LOC100498532NP_001333498.1 Tryp_SPc 25..247 CDD:238113 81/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47996
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.