Protein Alignment eyg and Sdcbp

DIOPT Version :9

• Sequence 1: NP_001014582.1
• Gene: eyg / 39419
• FlyBaseID: FBgn0000625
• Length: 670
• Species: Drosophila melanogaster
• Sequence 2: NP_114192.1
• Gene: Sdcbp / 83841
• RGDID: 621497
• Length: 300
• Species: Rattus norvegicus
• Alignment Length: 49
• Identity: 11/49 - (22%)
• Similarity: 19/49 - (38%)
• Gaps: 14/49 - (28%)

  Fly   612 QSGGSTMTVDNSSSDSDEEINVHDDSDGEI--------------ESSAA 646
            |:.|..:|:.......:..:.:|.||.|.:              :||||
  Rat   182 QAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAA 230

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
eyg	NP_001014582.1	HTH	120..217	CDD:304362
		Homeobox	352..404	CDD:278475
Sdcbp	NP_114192.1	Interaction with PDCD6IP. /evidence=ECO:0000250|UniProtKB:O08992	2..104
		LYPX(n)L motif 1. /evidence=ECO:0000250|UniProtKB:O08992	3..7
		LYPX(n)L motif 2. /evidence=ECO:0000250|UniProtKB:O08992	47..51
		LYPX(n)L motif 3. /evidence=ECO:0000250|UniProtKB:O08992	51..55
		PDZ_signaling	114..193	CDD:238492	3/10 (30%)
		PDZ_signaling	198..271	CDD:238492	8/33 (24%)
		phosphatidylinositol-4, 5-bisphosphate-binding. /evidence=ECO:0000250|UniProtKB:O00560	252..253

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0849
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900