powered by:
Protein Alignment eyg and Sdcbp
DIOPT Version :9
Sequence 1: | NP_001014582.1 |
Gene: | eyg / 39419 |
FlyBaseID: | FBgn0000625 |
Length: | 670 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_114192.1 |
Gene: | Sdcbp / 83841 |
RGDID: | 621497 |
Length: | 300 |
Species: | Rattus norvegicus |
Alignment Length: | 49 |
Identity: | 11/49 - (22%) |
Similarity: | 19/49 - (38%) |
Gaps: | 14/49 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 612 QSGGSTMTVDNSSSDSDEEINVHDDSDGEI--------------ESSAA 646
|:.|..:|:.......:..:.:|.||.|.: :||||
Rat 182 QAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAA 230
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0849 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.