DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eyg and Pax4

DIOPT Version :9

Sequence 1:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_113987.1 Gene:Pax4 / 83630 RGDID:620433 Length:349 Species:Rattus norvegicus


Alignment Length:410 Identity:132/410 - (32%)
Similarity:169/410 - (41%) Gaps:140/410 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 GLRGYDIAQHMLTQQGAVSKLLGS------LRPPGLIGGSKPKVATPTVVSKIEQYKRENPTIFA 188
            |:|..||::.:....|.|||:||.      |.|.| ||||||::|||.||::|.|.|.|.|.:||
  Rat    37 GMRPCDISRSLKVSNGCVSKILGRYYRTGVLEPKG-IGGSKPRLATPAVVARIAQLKDEYPALFA 100

  Fly   189 WEIRERLISEGVCTNATAPSVSSINRILRNRAAERVATEFARTAAYGLYPPPPHPYGSFTWHPAG 253
            |||:.:|.:||:||...|||||||||:|      |...|..|.....|..|              
  Rat   101 WEIQRQLCAEGLCTQDKAPSVSSINRVL------RALQEDQRLHWTQLRSP-------------- 145

  Fly   254 NVPGGQGVPPPPPPSALWSVAAPTLANLPPSAASAVPVSTCGSLSSAHLMAGGAGGTPTNRAISP 318
                              :|.||.|    ||     |.|.|.:....|                |
  Rat   146 ------------------AVLAPAL----PS-----PHSNCEAPRGPH----------------P 167

  Fly   319 GSGSHDTLESADENRHIDSDYLDDDDEPKFRRNRTTFSPEQLEELEKEFDKSHYPCVSTRERLSS 383
            |: ||                          ||||.|||.|.|.|||||.:..||....|.:|::
  Rat   168 GT-SH--------------------------RNRTIFSPGQAEALEKEFQRGQYPDSVVRGKLAA 205

  Fly   384 RTSLSEARVQVWFSNRRAKWRRHQRMNLLKRQRSSPA----------NP--LHSQQSNDAPASSP 436
            .|||.|..|:||||||||||||.::   ||.:...|.          :|  :.:|||   |.|.|
  Rat   206 ATSLPEDTVRVWFSNRRAKWRRQEK---LKWETQMPGASQDLMVPKDSPGIISAQQS---PGSVP 264

  Fly   437 T---------------------PSNHSSASTS-APVAPVPPPQQPLPLCGDHSPQGPPPSVLLHP 479
            :                     |...||.:|| |.:.|.......||:......:...|.:..||
  Rat   265 SAALPVLEQLNPSFCQLCWGAVPDRCSSDTTSQACLQPYWECHSLLPVASSSYMEFAWPCLTTHP 329

  Fly   480 LH---GPPGGHHHHHPLHLP 496
            :|   |.||.....:.||.|
  Rat   330 VHHLIGGPGQAPSTYYLHWP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eygNP_001014582.1 HTH 120..217 CDD:304362 48/92 (52%)
Homeobox 352..404 CDD:278475 30/51 (59%)
Pax4NP_113987.1 PAX 5..129 CDD:128645 49/98 (50%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 8..64 10/26 (38%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 83..131 28/53 (53%)
Homeobox 174..226 CDD:278475 30/51 (59%)
Transcription repression 278..349 18/70 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.