DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eyg and HDG7

DIOPT Version :10

Sequence 1:NP_524042.2 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001332093.1 Gene:HDG7 / 835293 AraportID:AT5G52170 Length:687 Species:Arabidopsis thaliana


Alignment Length:100 Identity:27/100 - (27%)
Similarity:52/100 - (52%) Gaps:16/100 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 ENRHIDSDYLD----DDDE----PKFRRNRTTF---SPEQLEELEKEFDKSHYPCVSTRERLSSR 384
            |:|.:..|..|    |:|:    ||.::.:|.:   :..|::|||..|.:..:|....|..|..:
plant    29 ESRSLSDDSFDAMSGDEDKQEQRPKKKKRKTKYHRHTSYQIQELESFFKECPHPNEKQRLELGKK 93

  Fly   385 TSLSEARVQVWFSNRRAKWR----RHQRMNLLKRQ 415
            .:|...:::.||.|||.:.:    ||:.: :||::
plant    94 LTLESKQIKFWFQNRRTQMKTQLERHENV-ILKQE 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eygNP_524042.2 HTH_ARSR 120..217 CDD:481197
Homeodomain 349..405 CDD:459649 15/62 (24%)
HDG7NP_001332093.1 Homeodomain 61..113 CDD:459649 14/51 (27%)
START_ArGLABRA2_like 220..425 CDD:176884
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.