DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eyg and HB-12

DIOPT Version :9

Sequence 1:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_191748.1 Gene:HB-12 / 825362 AraportID:AT3G61890 Length:235 Species:Arabidopsis thaliana


Alignment Length:156 Identity:36/156 - (23%)
Similarity:58/156 - (37%) Gaps:47/156 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 KFRRNRTTFSPEQLEELEKEFDKSHYPCVSTRERLSSRTSLSEAR--------VQVWFSNRRAKW 403
            |...|:..||.||::.||..|:        :..||..|..:..||        |.:||.|:||:|
plant    26 KKSNNQKRFSEEQIKSLELIFE--------SETRLEPRKKVQVARELGLQPRQVAIWFQNKRARW 82

  Fly   404 RRHQ-----------------RMNLLKRQRSSPANPLHSQQSNDAPASSPTPSNHS--------- 442
            :..|                 :..::|:::.|..:.|  |:.|:.........:|.         
plant    83 KTKQLEKEYNTLRANYNNLASQFEIMKKEKQSLVSEL--QRLNEEMQRPKEEKHHECCGDQGLAL 145

  Fly   443 SASTSAPVAPVPPP---QQPLPLCGD 465
            |:||.:......|.   .|...||.|
plant   146 SSSTESHNGKSEPEGRLDQGSVLCND 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eygNP_001014582.1 HTH 120..217 CDD:304362
Homeobox 352..404 CDD:278475 18/59 (31%)
HB-12NP_191748.1 Homeobox 33..83 CDD:395001 18/57 (32%)
HALZ 85..127 CDD:396657 6/43 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.