DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eyg and pax2

DIOPT Version :9

Sequence 1:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001037888.1 Gene:pax2 / 733478 XenbaseID:XB-GENE-486801 Length:140 Species:Xenopus tropicalis


Alignment Length:130 Identity:65/130 - (50%)
Similarity:86/130 - (66%) Gaps:14/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PGFGGGGSTGGIPHGAGGPTGSTLNTLMSQHRLLEFSRFGGLRGYDIAQHMLTQQGAVSKLL--- 151
            ||.||....||:     ...|..|..::.| |::|.:. .|:|..||::.:....|.|||:|   
 Frog    15 PGHGGVNQLGGV-----FVNGRPLPDVVRQ-RIVELAH-QGVRPCDISRQLRVSHGCVSKILGRY 72

  Fly   152 ---GSLRPPGLIGGSKPKVATPTVVSKIEQYKRENPTIFAWEIRERLISEGVCTNATAPSVSSIN 213
               ||:: ||:|||||||||||.||.||.:|||:|||:||||||:||::||:|.|.|.|||||||
 Frog    73 YETGSIK-PGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSIN 136

  Fly   214  213
             Frog   137  136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eygNP_001014582.1 HTH 120..217 CDD:304362 56/100 (56%)
Homeobox 352..404 CDD:278475
pax2NP_001037888.1 PAX 16..137 CDD:128645 64/129 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.