DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eyg and DUXA

DIOPT Version :9

Sequence 1:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001012747.1 Gene:DUXA / 503835 HGNCID:32179 Length:204 Species:Homo sapiens


Alignment Length:116 Identity:37/116 - (31%)
Similarity:56/116 - (48%) Gaps:24/116 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 DTLESADENRHIDSDYLDDDDEP-------KFRRNRTTFSPEQLEELEKEFDKSHYPCVSTRERL 381
            :||||:..         ...|:|       :.||.|||:|..||..|.|.|.|:.||.:.:||.|
Human    79 ETLESSQS---------QGQDQPGVEFQSREARRCRTTYSASQLHTLIKAFMKNPYPGIDSREEL 134

  Fly   382 SSRTSLSEARVQVWFSNRRAKWRRHQRMNLLKRQRSSPANPLHSQQSNDAP 432
            :....:.|:|||:||.|||::        ||.:::..|...|..::....|
Human   135 AKEIGVPESRVQIWFQNRRSR--------LLLQRKREPVASLEQEEQGKIP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eygNP_001014582.1 HTH 120..217 CDD:304362
Homeobox 352..404 CDD:278475 24/51 (47%)
DUXANP_001012747.1 homeodomain 16..74 CDD:238039
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..101 6/30 (20%)
Homeobox 105..155 CDD:278475 24/49 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..204 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.