DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eyg and Pph13

DIOPT Version :9

Sequence 1:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:362 Identity:104/362 - (28%)
Similarity:145/362 - (40%) Gaps:78/362 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 KFRRNRTTFSPEQLEELEKEFDKSHYPCVSTRERLSSRTSLSEARVQVWFSNRRAKWRRHQRMNL 411
            |.||.||||:..||:|||:.|.::|||.|..||.|:.|..|:||||||||.|||||||:.:::..
  Fly     9 KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGG 73

  Fly   412 LKRQRSSPANPLHSQQSNDAPASSPTPSNHSSASTSAPVAPVPPPQQPLPL---------CGDHS 467
            |.......|..|.....:.|...    ...|:......:.|..|||....|         .|..|
  Fly    74 LGGDYKEGALDLDVSYDDSAVLG----QLDSALGGGGTLLPDTPPQSSNSLDNELKASYGTGAMS 134

  Fly   468 PQGPPPSVLLH----PLHGPPGGHHHHHPLHLPTHPAALQLLSHYHQQQQQQQQQ---------- 518
            |....|::.|:    .|....||  ....:...|:|...|..:|.......|.||          
  Fly   135 PSRLSPNIFLNLNIDHLGLERGG--SGLSMEWSTYPPQTQAQTHPQMDSDNQLQQHPPQQHASDP 197

  Fly   519 ------QHQQQQQQHHQQQQQLSPSGCNPAANHLSMGGERSAFRSLVSSPSAAA-----FLGL-A 571
                  .|.|||||.|||:|.      ||   .|..|.|.:|..||..:..::|     ||.: .
  Fly   198 IHAGSSSHHQQQQQQHQQEQH------NP---QLHPGLEFAASLSLDMTDGSSAYDEMKFLSVDV 253

  Fly   572 RQYAV---AASLTVAEEQRSRLHYSAGG----LGSGGE----GTGPNTNTTQSG-----GSTMTV 620
            .|:.:   .|...::.||.....|  ||    :||..|    |.|.::...:.|     .|.:.:
  Fly   254 DQFTIDSFKADCILSMEQSQMQAY--GGHSQLVGSSNELCLDGIGMSSFGMEEGEPKSPPSLLVL 316

  Fly   621 DNS----------SSDSDEEINVHDDSDGEIESSAAT 647
            |.|          .:|..|:::.|....|.:.....|
  Fly   317 DKSLPSLSIGVEGIADLVEQLHHHQHEGGPVGGGVIT 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eygNP_001014582.1 HTH 120..217 CDD:304362
Homeobox 352..404 CDD:278475 32/51 (63%)
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 32/51 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450818
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.