DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eyg and al

DIOPT Version :9

Sequence 1:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:425 Identity:125/425 - (29%)
Similarity:165/425 - (38%) Gaps:120/425 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 PPPSALWSVAAPTLANLPP--SAASA-----VPVSTCGSLSSAHLMAGGAGGTPTNRAISPGSGS 322
            |..:.|....|..|.:..|  |||||     |.:|..|...|.  .:|.:||  ||..:|.|   
  Fly    13 PQEAKLAHPDAVVLVDRAPGSSAASAGAALTVSMSVSGGAPSG--ASGASGG--TNSPVSDG--- 70

  Fly   323 HDTLESADENRHIDSDYLDDDDEP--KFRRNRTTFSPEQLEELEKEFDKSHYPCVSTRERLSSRT 385
                         :||...|:..|  |.||.||||:..|||||||.|.::|||.|.|||.|:.:.
  Fly    71 -------------NSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKI 122

  Fly   386 SLSEARVQVWFSNRRAKWRRHQRMNLLKRQRSSPANP-----LHSQQSNDAPASSPTPSNHSSAS 445
            .|:|||:||||.|||||||:.:::.    .:|.|.||     ..:.|:....|..|.|..|....
  Fly   123 GLTEARIQVWFQNRRAKWRKQEKVG----PQSHPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQ 183

  Fly   446 ---------------------TSAPVAP---------VPPPQQPLPLCGDHSPQGPPPSVLLH-- 478
                                 ::||:.|         .||...|..:.|.:||.....|:|.:  
  Fly   184 LRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMT 248

  Fly   479 ------PLHGPP----GGHHHHHPLHL----PTHPAALQLLSHYHQQQQQQQQQQH--------- 520
                  ||..||    |....|.|.|:    ||.||:      .|..|.||....|         
  Fly   249 AVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPAS------GHASQHQQHPTAHPPPPQAPPQ 307

  Fly   521 -------QQQQQQH------HQQQQQLSPSGCNPAANHLSMGGERS----AFRSLVSSPSAAAFL 568
                   .|...||      .||...|||:..:|.|..||...:|.    :.::....|.||...
  Fly   308 MPVGVQPAQLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQRQLPPPSHQAPPPPPRAATPP 372

  Fly   569 GLARQYAVAASLTVAEEQRSRLHYSAGGLGSGGEG 603
            ...|..::||....|.|...:|..    |...|.|
  Fly   373 EDRRTSSIAALRLKAREHELKLEL----LRQNGHG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eygNP_001014582.1 HTH 120..217 CDD:304362
Homeobox 352..404 CDD:278475 33/51 (65%)
alNP_722629.1 Homeobox 89..141 CDD:278475 33/51 (65%)
OAR 374..391 CDD:281777 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450819
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.